PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0177s0310.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 336aa    MW: 37920.1 Da    PI: 8.4621
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0177s0310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.4e-2577120144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg+srsrk++e
  SapurV1A.0177s0310.2.p  77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKSRSRKPVE 120
                             79***************************************986 PP

2QLQ59.88e-211246236
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                            +FT +Q+q+L++Q+l+yKy+++++PvPpeLl a++
  SapurV1A.0177s0310.2.p 12 PFTSTQWQELEHQALIYKYMVSGVPVPPELLYAVK 46
                            8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-121147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-161245IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9141247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.94177121IPR014977WRC domain
PfamPF088792.0E-2078120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MLNTAITRNR FPFTSTQWQE LEHQALIYKY MVSGVPVPPE LLYAVKRSLE SSLASRLFPH  60
QPSGWGCFQA GFGRKADPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GKSRSRKPVE  120
LASSTPTTTA TIPLINRNLS NPTVSPSSSS YSFSHPSSSA ESEVYAHQNS SHRTFLYPHS  180
SSSGPPESVF YPQNSTPHNL FLEPGSSPHA DKQHRHYHGM REDVDERAFF PDGLVRARGV  240
QDSYNQLPMS SYKGYSLPQF QTFADTSKEE QPQPGQHCFV LGTDIIKSSA TRSIKLEKET  300
ETLKPLHHFF DQWEPKDADS WLDLASSSRP HTADD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175881e-103AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035717.10.0PREDICTED: growth-regulating factor 5-like
TrEMBLB9GKU60.0B9GKU6_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0001s16920.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-63growth-regulating factor 5